rAAV custom CRIPSR Direct production Gentaur SolutionsCRISPR Solutions – ReagentsCRISPR Solutions – KO ServiceCell Engineering SolutionsR … read more 22nd May 2024 rAAV custom CRIPSR Direct production
Uncovering the Tiny Wonders: An All-Inclusive Investigation of Cellular Biology Welcome to our in-depth investigation of the complex world of cells, which are the building blocks o … read more 2nd Apr 2024
Volume 11, Issue 2 (2019) Volume 11, Issue 2 (2019)Table of ContentsExtractable Protein Levels in Latex Products, and their As … read more 30th Nov 2021 Lieven M G GEVAERT
Description Additional Information Description SLC7A10 Antibody | 292-ASC-112AP Expression system: Yeast Purity: > 90% SDS-PAGE Suitable for: SDS-PAGE Product name Recombinant Mouse SLC7A10 protein (Tagged) Purity > 90 % SDS-PAGE. Expression system Yeast Accession P63115 Protein length Protein fragment Animal free No Nature Recombinant Species Mouse Sequence WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ Amino acids 475 to 530 Additional sequence information N-terminal 6xHis-sumostar-tagged View AllClose Additional Information Size: 100 µg View AllClose
Add to Cart Quick view TK Antibody | Gentaur Gentaur MSRP: Now: $340 Was: TK Antibody | 399-CSB-PA234835
